PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_41608_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 461aa    MW: 52634 Da    PI: 6.3984
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_41608_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.41.9e-19222268148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WTteEd ll+++v+q+G + W+ Ia++++ gR +kqc++rw+++l
   Neem_41608_f_1 222 KGQWTTEEDRLLIRLVEQYGIRKWSHIAQMLP-GRIGKQCRERWHNHL 268
                      799*****************************.*************97 PP

2Myb_DNA-binding57.33.6e-18274316145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd+ l++a+++ G++ W+ Ia++++ gRt++++k++w+
   Neem_41608_f_1 274 KDTWSEEEDKALIEAHAEIGNK-WAEIAKRLP-GRTENSIKNHWN 316
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.91217272IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-26217271IPR009057Homeodomain-like
SuperFamilySSF466894.4E-32219315IPR009057Homeodomain-like
SMARTSM007171.1E-17221270IPR001005SANT/Myb domain
CDDcd001677.78E-17225268No hitNo description
PfamPF139211.8E-19225283No hitNo description
Gene3DG3DSA:1.10.10.601.1E-22272321IPR009057Homeodomain-like
SMARTSM007171.5E-17273321IPR001005SANT/Myb domain
PROSITE profilePS5129421.387273323IPR017930Myb domain
CDDcd001678.51E-14276319No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MHSDVHLLRN TKVTVPKSSN ISFDQIVAAC MELDTKLGEI HAANQPVFLS ENYIKPYMKN  60
DIPFDVPSSK GTYLQEFDHH LDDHQFHVTG SSSYPVFGVQ TPCFDSFDSF PYNYSSNFDL  120
YECKPFADGN GGHGQVMDNF QSGGYLNNRQ VNPVNMVGSN QARMPLDFQE MKPVNFAVPD  180
EVSCVGADQN GYYKKAGLNK NNRPYPPARR TIKIGKKSNV VKGQWTTEED RLLIRLVEQY  240
GIRKWSHIAQ MLPGRIGKQC RERWHNHLRP DIKKDTWSEE EDKALIEAHA EIGNKWAEIA  300
KRLPGRTENS IKNHWNATKR RQFSKRKCRS KYPRASLLQE YIKSLNLDSS SSKQQRKTSN  360
NAAATAGNIN NIKNKAQNQT PAEDFCPTDH LVPDFDFNEV PEFDFDDKLF EENCSIDSLI  420
EEMPCAPVVD EKSLEMDVQL DVESEVKKEL DLVEMISQAN L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-452203222104C-Myb DNA-Binding Domain
1msf_C1e-452203222104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006477545.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L21e-102MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A067FTX00.0A0A067FTX0_CITSI; Uncharacterized protein
STRINGGLYMA05G02300.21e-167(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-101myb domain protein 98